PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G142600.1
Common NameB456_003G142600, LOC105788952
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family GATA
Protein Properties Length: 344aa    MW: 37384.6 Da    PI: 5.9303
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G142600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.12.4e-18258292135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C +C +tkTp+WR+gp g+ktLCnaCG+++r+ +l
  Gorai.003G142600.1 258 CLHCEVTKTPQWREGPMGPKTLCNACGVRFRSGRL 292
                         99*****************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.372252288IPR000679Zinc finger, GATA-type
SMARTSM004011.5E-17252306IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.5E-14256289IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577163.28E-14256315No hitNo description
CDDcd002021.00E-14257304No hitNo description
PfamPF003203.2E-16258292IPR000679Zinc finger, GATA-type
PROSITE patternPS003440258283IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MNNSWFDEGF DGVNDDFFDD VIKYLDFPLE DVEGTDGGDG SSGEGVIDFH LPLDDDVEQN  60
NSGGGEEWDC NFQNLEPPPA NVLAGMSSGF SGDFFNDSSP KCLTVSCDGS SQLNQWSSVT  120
EASSGRSVTL HSESTDVKGS IRFQTSSPVS VLESSSTCSA ANPVPINPKL GFLVKRGRSK  180
RRRASAFNVH FTLPFTSSTS STSRGSNSSV GSESESESHL TEEPAKKRLK KKMNLTWLSD  240
FSEMKKSPSR QPIEVRKCLH CEVTKTPQWR EGPMGPKTLC NACGVRFRSG RLLPEYRPAA  300
SPTFVPALHS NSHKKVVEMR KQANLPMTGT PPMLSIPQAP ISM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012471520.10.0PREDICTED: GATA transcription factor 11-like isoform X1
TrEMBLA0A0D2RMG90.0A0A0D2RMG9_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.24e-40GATA transcription factor 11
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]